Micron Document




Fuzzy complex
──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────
top
Fuzzy complexes are protein complexes, where structural ambiguity or multiplicity exists and is required for biological function.cite-ref-fc1-1-0[1]cite-ref-fc2-2-0[2] Alteration, truncation or removal of conformationally ambiguous regions impacts the activity of the corresponding complex.cite-ref-fc3-3-0[3]cite-ref-fc4-4-0[4]cite-ref-fc5-5-0[5] Fuzzy complexes are generally formed by intrinsically disordered proteins.cite-ref-fc6-6-0[6]cite-ref-fc7-7-0[7] Structural multiplicity usually underlies functional multiplicity of protein complexes cite-ref-fc8-8-0[8]cite-ref-fc9-9-0[9]cite-ref-fc10-10-0[10] following a fuzzy logic. Distinct binding modes of the nucleosome are also regarded as a special case of fuzziness.cite-ref-fc11-11-0[11]cite-ref-fc12-12-0[12]

Contents


──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────

Historical background

For almost 50 years molecular biology was based on two dogmas: (i) equating biological function of the protein with a unique three-dimensional structure and (ii) assuming exquisite specificity in protein complexes. Specificity/selectivity is ensured by unambiguous set of interactions formed between the protein and its ligand (another protein, DNA, RNA or small molecule). Many protein complexes however, contain functionally important/critical regions, which remain highly dynamic in the complex or adopt different conformations.cite-ref-fc13-13-0[13] This phenomenon is defined fuzziness. The most pertinent example is the cyclin-dependent kinase inhibitor Sic1, which binds to the SCF subunit of Cdc4 in a phosphorylation dependent manner.cite-ref-fc14-14-0[14] No regular secondary structures are gained upon phosphorylation and the different phosphorylation sites interchange in the complex.cite-ref-fc15-15-0[15]

Classification of fuzzy complexes

Structural ambiguity in protein complexes covers a wide spectrum.cite-ref-fc1-1-1[1] In a polymorphic complex, the protein adopts two or more different conformations upon binding to the same partner, and these conformations can be resolved.cite-ref-fc16-16-0[16] Clamp,cite-ref-fc17-17-0[17] flanking cite-ref-fc18-18-0[18]cite-ref-fc19-19-0[19] and random complexescite-ref-fc20-20-0[20]cite-ref-fc21-21-0[21] are dynamic, where ambiguous conformations interchange with each other and cannot be resolved. Interactions in fuzzy complexes are usually mediated by short motifs.cite-ref-fc22-22-0[22] Flanking regions are tolerant to sequence changes as long as the amino acid composition is maintained, for example in case of linker histone C-terminal domains cite-ref-fc24-23-0[23] and H4 histone N-terminal domains.cite-ref-fc25-24-0[24]

Regulatory pathways via fuzzy regions

Fuzzy regions modulate the conformational equilibrium cite-ref-fc26-25-0[25] or flexibility cite-ref-fc3-3-1[3]cite-ref-fc27-26-0[26] of the binding interface via transient interactions.cite-ref-fc28-27-0[27] Dynamic regions can also compete with binding sitescite-ref-fc29-28-0[28] or tether them to the target.cite-ref-fc30-29-0[29] Modifications of fuzzy regions by further interactions,cite-ref-fc8-8-1[8]cite-ref-fc31-30-0[30] or posttranslational modificationscite-ref-fc32-31-0[31]cite-ref-fc33-32-0[32] impact binding affinity or specificity. Alternative splicing can modulate the length of fuzzy regions resulting in context-dependent binding (e.g. tissue-specificity) on the complex.cite-ref-fc34-33-0[33]cite-ref-fc35-34-0[34]cite-ref-fc36-35-0[35] EGF/MAPK, TGF-β and WNT/Wingless signaling pathways employ tissue-specific fuzzy regions.

References

cite-note-fc1-11. citereftompafuxreiter2008Tompa, Peter; Fuxreiter, Monika (2008). "Fuzzy complexes: Polymorphism and structural disorder in protein–protein interactions". Trends in Biochemical Sciences. 33 (1): 2–8. doi:10.1016/j.tibs.2007.10.003. PMID 18054235.
cite-note-fc2-22. Fuxreiter, M. & Tompa, P. (2011) Fuzziness: Structural Disorder in Protein Complexes Austin, New York.
cite-note-fc3-33. citerefpufallleenelsonkang2005Pufall, M. A; Lee, Gregory M; Nelson, Mary L; Kang, Hyun-Seo; Velyvis, Algirdas; Kay, Lewis E; McIntosh, Lawrence P; Graves, Barbara J (2005). "Variable Control of Ets-1 DNA Binding by Multiple Phosphates in an Unstructured Region". Science. 309 (5731): 142–5. Bibcode:2005Sci...309..142P. doi:10.1126/science.1111915. PMID 15994560.
cite-note-fc4-44. citerefbhattacharyyarem-nyigoodbashor2006Bhattacharyya, R. P; Reményi, Attila; Good, Matthew C; Bashor, Caleb J; Falick, Arnold M; Lim, Wendell A (2006). "The Ste5 Scaffold Allosterically Modulates Signaling Output of the Yeast Mating Pathway". Science. 311 (5762): 822–6. Bibcode:2006Sci...311..822B. doi:10.1126/science.1120941. PMID 16424299. S2CID 13882487.
cite-note-fc5-55. citerefliumatthewsbondos2009Liu, Ying; Matthews, Kathleen S; Bondos, Sarah E (2009). "Internal Regulatory Interactions Determine DNA Binding Specificity by a Hox Transcription Factor". Journal of Molecular Biology. 390 (4): 760–74. doi:10.1016/j.jmb.2009.05.059. PMC 2739810. PMID 19481089.
cite-note-fc6-66. citerefromeroobradovickissingervillafranca1998Romero, P; Obradovic, Z; Kissinger, C. R; Villafranca, J. E; Garner, E; Guilliot, S; Dunker, A. K (1998). "Thousands of proteins likely to have long disordered regions". Pacific Symposium on Biocomputing: 437–48. PMID 9697202.
cite-note-fc7-77. citerefwrightdyson1999Wright, Peter E; Dyson, H. Jane (1999). "Intrinsically unstructured proteins: Re-assessing the protein structure-function paradigm". Journal of Molecular Biology. 293 (2): 321–31. doi:10.1006/jmbi.1999.3110. PMID 10550212.
cite-note-fc8-88. citerefgaleanoursewangsivakolundu2008Galea, Charles A; Nourse, Amanda; Wang, Yuefeng; Sivakolundu, Sivashankar G; Heller, William T; Kriwacki, Richard W (2008). "Role of Intrinsic Flexibility in Signal Transduction Mediated by the Cell Cycle Regulator, p27Kip1". Journal of Molecular Biology. 376 (3): 827–38. doi:10.1016/j.jmb.2007.12.016. PMC 2350195. PMID 18177895.
cite-note-fc9-99. citereffuxreitertompasimonuversky2008Fuxreiter, Monika; Tompa, Peter; Simon, István; Uversky, Vladimir N; Hansen, Jeffrey C; Asturias, Francisco J (2008). "Malleable machines take shape in eukaryotic transcriptional regulation". Nature Chemical Biology. 4 (12): 728–37. doi:10.1038/nchembio.127. PMC 2921704. PMID 19008886.
cite-note-fc10-1010. citerefwangfishermathewou2011Wang, Yuefeng; Fisher, John C; Mathew, Rose; Ou, Li; Otieno, Steve; Sublet, Jack; Xiao, Limin; Chen, Jianhan; Roussel, Martine F; Kriwacki, Richard W (2011). "Intrinsic disorder mediates the diverse regulatory functions of the Cdk inhibitor p21". Nature Chemical Biology. 7 (4): 214–21. doi:10.1038/nchembio.536. PMC 3124363. PMID 21358637.
cite-note-fc11-1111. citerefbelchyangliumalkaram2010Belch, Yaakov; Yang, Jingyi; Liu, Yang; Malkaram, Sridhar A; Liu, Rong; Riethoven, Jean-Jack M; Ladunga, Istvan (2010). "Weakly Positioned Nucleosomes Enhance the Transcriptional Competency of Chromatin". PLOS ONE. 5 (9): e12984. Bibcode:2010PLoSO...512984B. doi:10.1371/journal.pone.0012984. PMC 2945322. PMID 20886052.
cite-note-fc12-1212. citereftsuidubuisgebbiamorse2011Tsui, K; Dubuis, S; Gebbia, M; Morse, R. H; Barkai, N; Tirosh, I; Nislow, C (2011). "Evolution of Nucleosome Occupancy: Conservation of Global Properties and Divergence of Gene-Specific Patterns". Molecular and Cellular Biology. 31 (21): 4348–55. doi:10.1128/MCB.05276-11. PMC 3209338. PMID 21896781.
cite-note-fc13-1313. citereffuxreiter2012Fuxreiter, Monika (2012). "Fuzziness: Linking regulation to protein dynamics". Molecular BioSystems. 8 (1): 168–77. doi:10.1039/c1mb05234a. hdl:2437/124519. PMID 21927770.
cite-note-fc14-1414. citerefnashtangorlickychen2001Nash, Piers; Tang, Xiaojing; Orlicky, Stephen; Chen, Qinghua; Gertler, Frank B; Mendenhall, Michael D; Sicheri, Frank; Pawson, Tony; Tyers, Mike (2001). "Multisite phosphorylation of a CDK inhibitor sets a threshold for the onset of DNA replication". Nature. 414 (6863): 514–21. Bibcode:2001Natur.414..514N. doi:10.1038/35107009. PMID 11734846. S2CID 16924667.
cite-note-fc15-1515. citerefmittagorlickychoytang2008Mittag, T; Orlicky, S; Choy, W.-Y; Tang, X; Lin, H; Sicheri, F; Kay, L. E; Tyers, M; Forman-Kay, J. D (2008). "Dynamic equilibrium engagement of a polyvalent ligand with a single-site receptor". Proceedings of the National Academy of Sciences. 105 (46): 17772–7. Bibcode:2008PNAS..10517772M. doi:10.1073/pnas.0809222105. JSTOR 25465359. PMC 2582940. PMID 19008353.
cite-note-fc16-1616. citerefdidrycantrellehussonroblin2012Didry, Dominique; Cantrelle, Francois-Xavier; Husson, Clotilde; Roblin, Pierre; Moorthy, Anna M Eswara; Perez, Javier; Le Clainche, Christophe; Hertzog, Maud; Guittet, Eric; Carlier, Marie-France; Van Heijenoort, Carine; Renault, Louis (2012). "How a single residue in individual β-thymosin/WH2 domains controls their functions in actin assembly". The EMBO Journal. 31 (4): 1000–13. doi:10.1038/emboj.2011.461. PMC 3280557. PMID 22193718.
cite-note-fc17-1717. citereffontestehkobe2000Fontes, Marcos R.M; Teh, Trazel; Kobe, Bostjan (2000). "Structural basis of recognition of monopartite and bipartite nuclear localization sequences by mammalian importin-α". Journal of Molecular Biology. 297 (5): 1183–94. doi:10.1006/jmbi.2000.3642. PMID 10764582.
cite-note-fc18-1818. citerefzormayrdysonmontminy2002Zor, Tsaffrir; Mayr, Bernhard M; Dyson, H. Jane; Montminy, Marc R; Wright, Peter E (2002). "Roles of Phosphorylation and Helix Propensity in the Binding of the KIX Domain of CREB-binding Protein by Constitutive (c-Myb) and Inducible (CREB) Activators". Journal of Biological Chemistry. 277 (44): 42241–8. doi:10.1074/jbc.M207361200. PMID 12196545.
cite-note-fc19-1919. citerefselenkogregorovicsprangersstier2003Selenko, Philipp; Gregorovic, Goran; Sprangers, Remco; Stier, Gunter; Rhani, Zakaria; Krämer, Angela; Sattler, Michael (2003). "Structural Basis for the Molecular Recognition between Human Splicing Factors U2AF65 and SF1/mBBP". Molecular Cell. 11 (4): 965–76. doi:10.1016/S1097-2765(03)00115-1. PMID 12718882.
cite-note-fc20-2020. citerefpometunchekmenevwittebort2004Pometun, Maxim S; Chekmenev, Eduard Y; Wittebort, Richard J (2004). "Quantitative Observation of Backbone Disorder in Native Elastin". Journal of Biological Chemistry. 279 (9): 7982–7. doi:10.1074/jbc.M310948200. PMID 14625282.
cite-note-fc21-2121. citerefsigalovaivazianstern2004Sigalov, Alexander; Aivazian, Dikran; Stern, Lawrence (2004). "Homooligomerization of the Cytoplasmic Domain of the T Cell Receptor ζ Chain and of Other Proteins Containing the Immunoreceptor Tyrosine-Based Activation Motif". Biochemistry. 43 (7): 2049–61. doi:10.1021/bi035900h. PMID 14967045.
cite-note-fc22-2222. citerefdaveytrav-gibson2011Davey, Norman E; Travé, Gilles; Gibson, Toby J (2011). "How viruses hijack cell regulation". Trends in Biochemical Sciences. 36 (3): 159–69. doi:10.1016/j.tibs.2010.10.002. PMID 21146412.
cite-note-fc24-2323. citerefluhamkaloparseghianhansen2009Lu, Xu; Hamkalo, Barbara; Parseghian, Missag H; Hansen, Jeffrey C (2009). "Chromatin Condensing Functions of the Linker Histone C-Terminal Domain Are Mediated by Specific Amino Acid Composition and Intrinsic Protein Disorder". Biochemistry. 48 (1): 164–72. doi:10.1021/bi801636y. PMC 2644900. PMID 19072710.
cite-note-fc25-2424. citerefmcbryantklonoskisorensennorskog2009McBryant, Steven J; Klonoski, Joshua; Sorensen, Troy C; Norskog, Sarah S; Williams, Sere; Resch, Michael G; Toombs, James A; Hobdey, Sarah E; Hansen, Jeffrey C (2009). "Determinants of Histone H4 N-terminal Domain Function during Nucleosomal Array Oligomerization". Journal of Biological Chemistry. 284 (25): 16716–22. doi:10.1074/jbc.M109.011288. PMC 2719306. PMID 19395382.
cite-note-fc26-2525. citerefnaudmcduffsauv-montagne2005Naud, Jean-François; McDuff, François-Olivier; Sauvé, Simon; Montagne, Martin; Webb, Bradley A; Smith, Steven P; Chabot, Benoit; Lavigne, Pierre (2005). "Structural and Thermodynamical Characterization of the Complete p21 Gene Product of Max". Biochemistry. 44 (38): 12746–58. doi:10.1021/bi0500729. PMID 16171389.
cite-note-fc27-2626. citerefleepufallmeekerkang2008Lee, Gregory M; Pufall, Miles A; Meeker, Charles A; Kang, Hyun-Seo; Graves, Barbara J; McIntosh, Lawrence P (2008). "The Affinity of Ets-1 for DNA is Modulated by Phosphorylation Through Transient Interactions of an Unstructured Region". Journal of Molecular Biology. 382 (4): 1014–30. doi:10.1016/j.jmb.2008.07.064. PMC 4808631. PMID 18692067.
cite-note-fc28-2727. citereffuxreitersimonbondos2011Fuxreiter, Monika; Simon, Istvan; Bondos, Sarah (2011). "Dynamic protein–DNA recognition: Beyond what can be seen". Trends in Biochemical Sciences. 36 (8): 415–23. doi:10.1016/j.tibs.2011.04.006. hdl:2437/124518. PMID 21620710.
cite-note-fc29-2828. citerefwatsonstottthomas2007Watson, Matthew; Stott, Katherine; Thomas, Jean O (2007). "Mapping Intramolecular Interactions between Domains in HMGB1 using a Tail-truncation Approach". Journal of Molecular Biology. 374 (5): 1286–97. doi:10.1016/j.jmb.2007.09.075. PMID 17988686.
cite-note-fc30-2929. citerefolsonnarayanaswamiviselowry2005Olson, Katie E; Narayanaswami, Pranesh; Vise, Pamela D; Lowry, David F; Wold, Marc S; Daughdrill, Gary W (2005). "Secondary Structure and Dynamics of an Intrinsically Unstructured Linker Domain". Journal of Biomolecular Structure and Dynamics. 23 (2): 113–24. doi:10.1080/07391102.2005.10507052. PMID 16060685. S2CID 37429006.
cite-note-fc31-3030. citerefahmedbammshisteiner-mosonyi2009Ahmed, Mumdooh A.M; Bamm, Vladimir V; Shi, Lichi; Steiner-Mosonyi, Marta; Dawson, John F; Brown, Leonid; Harauz, George; Ladizhansky, Vladimir (2009). "Induced Secondary Structure and Polymorphism in an Intrinsically Disordered Structural Linker of the CNS: Solid-State NMR and FTIR Spectroscopy of Myelin Basic Protein Bound to Actin". Biophysical Journal. 96 (1): 180–91. Bibcode:2009BpJ....96..180A. doi:10.1016/j.bpj.2008.10.003. PMC 2710047. PMID 19134474.
cite-note-fc32-3131. citerefjonkerwechselbergerpinksekaptein2006Jonker, Hendrik R. A; Wechselberger, Rainer W; Pinkse, Martijn; Kaptein, Robert; Folkers, Gert E (2006). "Gradual phosphorylation regulates PC4 coactivator function". FEBS Journal. 273 (7): 1430–44. doi:10.1111/j.1742-4658.2006.05165.x. hdl:1874/19762. PMID 16689930. S2CID 38856641.
cite-note-fc33-3232. citereftsunakatogayamaguchitate2009Tsunaka, Yasuo; Toga, Junko; Yamaguchi, Hiroto; Tate, Shin-Ichi; Hirose, Susumu; Morikawa, Kosuke (2009). "Phosphorylated Intrinsically Disordered Region of FACT Masks Its Nucleosomal DNA Binding Elements". Journal of Biological Chemistry. 284 (36): 24610–21. doi:10.1074/jbc.M109.001958. PMC 2782050. PMID 19605348.
cite-note-fc34-3333. citereftanakakawashimayehkamitani2003Tanaka, Tomoaki; Kawashima, Hidenori; Yeh, Edward T. H; Kamitani, Tetsu (2003). "Regulation of the NEDD8 Conjugation System by a Splicing Variant, NUB1L". Journal of Biological Chemistry. 278 (35): 32905–13. doi:10.1074/jbc.M212057200. PMID 12816948.
cite-note-fc35-3434. citerefliumatthewsbondos2008Liu, Ying; Matthews, Kathleen S; Bondos, Sarah E (2008). "Multiple Intrinsically Disordered Sequences Alter DNA Binding by the Homeodomain of the Drosophila Hox Protein Ultrabithorax". Journal of Biological Chemistry. 283 (30): 20874–87. doi:10.1074/jbc.M800375200. PMC 2475714. PMID 18508761.
cite-note-fc36-3535. citerefbrayerlynchwagner2011Brayer, K. J; Lynch, V. J; Wagner, G. P (2011). "Evolution of a derived protein-protein interaction between HoxA11 and Foxo1a in mammals caused by changes in intramolecular regulation". Proceedings of the National Academy of Sciences. 108 (32): E414–20. Bibcode:2011PNAS..108E.414B. doi:10.1073/pnas.1100990108. PMC 3156161. PMID 21788518.